DPCstruct | MC20235
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 263 ± 35 aa |
| Standard deviation of domain lengths | 35.19 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 19.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J2RBY1 | 251-464 | FSSGALGSGFKIEDSGHAEFQDVYIRGKLTSTVFEYETISTIGGNLLVLDGDVLDSDMTALDASTLVISGDTNFSVGDILRMKDGID… |
| A0A3R5ZSN9 | 51-314 | LSRKHDDAAEGMITFLRGLISEQMAQLKAGAQFGDFVSGLYNGKGGQVDANGNAEVESITVRTYMRVMELIVNRLSAQEGDTFFTES… |
| A0A1G6G7M5 | 104-410 | None |
| I9QKC7 | 116-387 | None |
| A0A318N7R1 | 457-715 | None |
| A0A7V9R3K7 | 336-591 | None |
| A0A5C7QAK5 | 185-474 | None |
| A0A496C5Q2 | 114-423 | None |
| A0A6I0LTM7 | 104-496 | None |
| A0A5M6A486 | 11-269 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.