DPCstruct | MC20234
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 114 ± 7 aa |
| Standard deviation of domain lengths | 7.24 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 81.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 24.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S4G8L9 | 2-117 | KAKLIIYILLTCIFTVSAQELKVTGFRAVPMDLSASTHMRRDANGTPCALVKVVLRAEGASFEGNVVGDTQFRTNEYWVYLTEGTKM… |
| A0A3R5ZBA5 | 13-127 | KVFALFILLLFSISVYSQELHVKSFGIAESDLSAQTQPRKDLNDKNCALVKVQFVGGISEIEGNVITPLIKHGNETWVYMPQGSRQM… |
| K5D8J1 | 11-120 | None |
| A0A660XGK3 | 10-117 | None |
| A0A4Q0J785 | 3-123 | None |
| A0A5P0X205 | 2-118 | None |
| A0A2N5YZT4 | 1-104 | None |
| R5UYC1 | 15-121 | None |
| A0A4S1ZEJ4 | 13-126 | None |
| R5VJ66 | 10-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.