DPCstruct | MC20230
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 114 ± 18 aa |
| Standard deviation of domain lengths | 18.34 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 91.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 30.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04809 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D5PEY1 | 24-143 | LHEIRHALARLWEQQEETVIDLRRIPLNADEEIRLSTFLGTGEVQATINAAGLTEIQETSYSGVWIETHHNSDGEILGKYISVSIVP… |
| A0A1Y1QH32 | 2-111 | QHEIHHALSELITHGTHGMIDLHSLPFSPQEYAALDEFLGEGEIDLTLNVLGKTRLRESGYAGVWRIEHFDDNDKRIGYFIEIGHVP… |
| A0A7C5FRG3 | 103-203 | None |
| A0A0S7ZX57 | 13-104 | None |
| A0A4Q2I3A6 | 1-135 | None |
| A0A3S4J8Y9 | 1-115 | None |
| H6SN22 | 214-327 | None |
| A0A625WA84 | 150-277 | None |
| A0A6D1GQT7 | 7-95 | None |
| A0A2X3M1V7 | 60-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.