DPCstruct | MC2023
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 127 ± 14 aa |
| Standard deviation of domain lengths | 14.38 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 25.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7D7WU80 | 2-126 | SARELSIICDACKLPVDDEEGYVWIDYGEINRYETAFRAWEEETGTELVPGRKVRSFMDVYNGPKRVRWQAHHKACDPDAGAGSYTI… |
| A0A2R5H354 | 22-149 | RNLGQRGTDDAGGQPHRFTFTCETCGEMIVGPTGYATLDRRAAAHRHHGFRAWRKANPGVHPRKGPHLVCWRVLHNSCDTEATEWDF… |
| A0A4Y9N1G2 | 24-147 | None |
| A0A1C5ACW3 | 6-133 | None |
| A0A419DDD5 | 3-121 | None |
| A0A2A3ETJ5 | 27-120 | None |
| A0A7I7WHR0 | 69-197 | None |
| A0A857KLD9 | 14-148 | None |
| A0A5N5W2K6 | 1-121 | None |
| A0A1R0KD24 | 26-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.