DPCstruct | MC20228
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 82 ± 10 aa |
| Standard deviation of domain lengths | 9.57 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 41.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0021 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A833KM20 | 14-90 | EEIFGDGVLEILSDGFGFLRSAAGSYLAGPDDIYVSPSQIRRFNLRTGDTITGTIRPPKEGERYFALLKVNQINYDT |
| A0A388NS44 | 48-131 | LGLRGGVLEIVDDSMGFLRGGNLMPSHDDIYVSQSQLRRFSLRTGDMVIGQVRAPKDSEKYHGLIRVESVNGLDPRGSQAPPAL |
| A0A0K2R4B0 | 173-265 | None |
| A0A1M3LG61 | 184-263 | None |
| A0A369L637 | 367-440 | None |
| A0A6G3VCC6 | 1-79 | None |
| A0A7V9HAH0 | 117-188 | None |
| A0A0K2RR81 | 248-338 | None |
| A0A1U8N4M4 | 375-448 | None |
| A0A6G2JCQ7 | 156-237 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.