DPCstruct | MC20227
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 124 ± 10 aa |
| Standard deviation of domain lengths | 9.69 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 92.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 20.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D7MIC6 | 2-127 | TTIREGSMERSVKMDMTTGEQITRFYIDGGVFGPVGARRIEETGTTISSISDRVYRIHPDDQLCAKATMDQECIFERETWKVKIKTT… |
| A0A388NRT2 | 7-138 | LKRQSVRRRWRKAGCVRHCTRARLQHDAAAGTYLLVDCTDEGRVLQTRSALLTDEVCTERFEITEGDPLSARRTTEWQMEFARGEWQ… |
| A0A840W094 | 479-599 | None |
| Q0TVT8 | 374-496 | None |
| A0A7W0WDS3 | 122-253 | None |
| A0A7W1GSI2 | 145-276 | None |
| A0A2N3ZUL3 | 6-126 | None |
| A0A6S7IDY3 | 243-371 | None |
| A0A2U3L2M9 | 60-197 | None |
| A0A7Y3AM75 | 289-399 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.