DPCstruct | MC20225
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 201 ± 29 aa |
| Standard deviation of domain lengths | 29.24 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 29.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V1KN29 | 77-318 | VLLLDEPTAHLDVRHQLELMQFVRERLCQGLVVVMALHDLNLAAAFADRLVVLRGGRVLAMGSPTEVLTPELVWEAFGVEAAVYRSP… |
| A0A1V6JXU6 | 2-199 | ISVFHDLNLAAYYCDRLIMLKEKRVVAVGEPRYVLTRENLNAVYGIDTLVKTHPLTGRPYILPVYGRAAKDRLYENVHVVCGGGTGS… |
| A0A7G9GG50 | 389-557 | None |
| A0A396R1U9 | 151-320 | None |
| A0A402CT71 | 162-403 | None |
| A0A1M5A953 | 11-202 | None |
| A0A1V5AQM7 | 1-228 | None |
| A0A3D0VZA0 | 14-217 | None |
| R6HC39 | 9-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.