DPCstruct | MC20222
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 115 ± 6 aa |
| Standard deviation of domain lengths | 5.52 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 88.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 37.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A091C109 | 2-114 | EKEAISTIKNHLSEVDSLTDPYVTQLRSDERKGVQQLLNQLEKRLAKEQDLKKQFYLMQTFERKCYQEGYRYLAGIDEVGRGPLAGP… |
| B1CAB8 | 4-119 | ISGISVNKLRKMFYDIKEDEYPDYIEAFINDGRREVNKFGERLIKKNEKYQMEIKRIENIKAFENSLHDEGYKYIAGIDEVGRGPLA… |
| A0A1G9PGH7 | 3-119 | None |
| A0A3S4P127 | 1-113 | None |
| W4PWV8 | 3-116 | None |
| A0A7V6XKD6 | 1-109 | None |
| A0A1I2C8H6 | 29-155 | None |
| A0A0K1P978 | 4-117 | None |
| A0A2E8HHF9 | 26-138 | None |
| I3U170 | 3-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.