DPCstruct | MC2022
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 49 ± 3 aa |
| Standard deviation of domain lengths | 2.71 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 86.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 50.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0533 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J6NCG4 | 15-61 | VLGKELATILVGLGALRFGDFTLTSGRRSPYYIDLRLLPSYPSALER |
| A0A803TB74 | 1-49 | SALSRALASALHAAKALRFGEFLLKSGLVSPVYVDLRATASEPSLMNKN |
| I3T086 | 1-51 | None |
| A0A3L6SP13 | 3-48 | None |
| A0A3B4ENW0 | 10-58 | None |
| A0A0A9XFF8 | 5-52 | None |
| A0A7E4RY81 | 58-105 | None |
| A0A0N4UCS1 | 18-69 | None |
| A0A287MLZ8 | 3-48 | None |
| A0A6P6XV31 | 176-227 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.