DPCstruct | MC20218
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 77 ± 13 aa |
| Standard deviation of domain lengths | 12.73 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 75.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.60 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 50.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B2VB17 | 1-76 | MLTPEQACSGCGCRGGPGYRGPSGRCVGWADIGRTCGTPPTTRCRAEGPNAGASEAAEHGVRALNARRPREQRQAF |
| A8IPR4 | 17-84 | MSGPVAAERGCGSRGGPGYRGPDGRCVGWANIGRVCGSPPTTRCTAEAPAADADQAAAFSSTHPRKPK |
| B8IW76 | 35-110 | None |
| A0A4Y3ZLE2 | 3-75 | None |
| A0A1Q8ZPI2 | 1-78 | None |
| A0A0N8GFV0 | 84-159 | None |
| A0A6N6T377 | 33-128 | None |
| A0A7V4PAH5 | 1-99 | None |
| A0A0D6JFX9 | 11-82 | None |
| A0A7C2IV02 | 7-100 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.