DPCstruct | MC20216
Metacluster Properties and Pfam Annotations
| Number of structural domains | 83 |
|---|---|
| Mean domain length (aa) | 106 ± 19 aa |
| Standard deviation of domain lengths | 18.68 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 92.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 35.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01341 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A397EAF5 | 4-97 | CSTISGATGGLHCVFDTSRNYRGSVGDEWCNSRSAGIGAPPGTDTGHPLVDYNLWLKVPGESDGTCSGRTPDAQEGPSAGLFFPDGF… |
| A0A7U8U2Q0 | 46-137 | GYGEAISGLTNGSHYVIDTSRNGAGPAPDAPLNWCNPSGRALGAPPTTATAGAHADAYLWIKRPGESDGTCGRGEPQAGRFVSQYAI… |
| D9UC73 | 123-221 | None |
| A0A5S4FWE4 | 4-95 | None |
| A0A5D0PIE5 | 633-732 | None |
| A0A067C8E0 | 469-563 | None |
| A0A7M3M5P2 | 124-223 | None |
| A0A7S2JPQ8 | 296-419 | None |
| A0A3F2UKU0 | 136-242 | None |
| A0A561V3Q4 | 44-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.