DPCstruct | MC20215
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 136 ± 12 aa |
| Standard deviation of domain lengths | 12.26 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 75.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 34.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G0X0Y3 | 213-338 | SSDCESDEEPESTFACTYHRSASSSGIILLDDVPFEFTRRSMFIVSDYICPCGECPWYDMIEKQVANTCGLSTKLKRQVCRILQAYS… |
| A0A397E6Y8 | 1-115 | MSDWDSWGDDDNGAIDYPRSGDRVVSFKACCDLTVSDYLCPCGDCPQYLDIELCVQKCCLPPRAKIAVCRILQAYSTYNESRGFQLS… |
| A0A024UPA9 | 227-379 | None |
| A0A485KJT9 | 89-226 | None |
| A0A1W0ABU4 | 64-187 | None |
| A0A662X091 | 201-336 | None |
| A0A662WGU6 | 91-233 | None |
| A0A662WU54 | 6-121 | None |
| A0A662YGW2 | 27-170 | None |
| A0A662YD59 | 97-245 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.