DPCstruct | MC20214
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 339 ± 34 aa |
| Standard deviation of domain lengths | 33.70 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 74.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 22.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3R7CXL8 | 3-292 | AGSVVLETPTCFRALDWLVTATSSYPSITAADLLTSSGFASLSAKDAAYFDSLCLPMTDVLPCLRRALLPALMPLLSSQPCCVALLE… |
| A0A397E5G9 | 8-357 | LHDFTDMLPHPIAECIGSVNASDLLAAVMPSLKDPVCATAYVSLLTWKGEVSSALVSVAGKVLTDKVFEAICAPFVDVIPCLESVLL… |
| A0A485KPM1 | 102-430 | None |
| A0A485KC86 | 45-358 | None |
| K3XCG0 | 1-367 | None |
| K3WX92 | 20-398 | None |
| A0A6G0XMY1 | 5-387 | None |
| G4ZVT3 | 222-586 | None |
| A0A7S1BPV6 | 243-567 | None |
| A0A6U5JXH1 | 353-637 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.