DPCstruct | MC20212
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 167 ± 24 aa |
| Standard deviation of domain lengths | 23.90 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 30.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A397DJB9 | 1-206 | MGGVRYDLCSNCYAFGAHGLENTDDMFGRVQELVLARCPRLAQEAELLELLRFEICRSNLRKFSFVANWLADIVQGRSTKDLRARAI… |
| T0S3E2 | 178-321 | LCESCYRSGVHGLEGSEAMETYDELLSDLKWMKACKAFTKPLLLMLRHDICNHSPSKYQFMCGWLADILGSKPVAKITMRGVAMKDL… |
| A0A1V9ZWI1 | 340-471 | None |
| A0A024GJ99 | 152-345 | None |
| K3WF59 | 406-568 | None |
| A0A067C5Q5 | 452-585 | None |
| A0A662Y853 | 437-605 | None |
| A0A6A5AM39 | 1-163 | None |
| A0A6G0PTJ2 | 276-445 | None |
| H3GBB4 | 60-250 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.