DPCstruct | MC20210
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 115 ± 11 aa |
| Standard deviation of domain lengths | 10.98 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 91.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 27.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W9QKA0 | 2-126 | KIGVYLCECGGNISKVVDLPNVAEFVKPFDDVAIIRQHSNMCSGAGQKLIIEDVKEHKLDKVVIAACSPQFHEKTFRGALEKAGLSP… |
| A0A832XJ57 | 1-97 | MEKKIGCYICTGCGIGEALDVKALGNIAAKEQKIPVVKNHEFLCGPEGINLIRNDMTAEGVNALVIVGCSHRVKTEEFRLGVAQMDR… |
| A0A7C4M9P0 | 4-126 | None |
| A0A7V6A332 | 11-129 | None |
| A0A0N8I014 | 1-118 | None |
| A0A351CFC5 | 353-460 | None |
| A0A1I6D1E4 | 1-111 | None |
| A0A6A2EX90 | 2-111 | None |
| A0A7C4R9W7 | 218-321 | None |
| A0A7C3QEC2 | 375-491 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.