DPCstruct | MC2021
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 86 ± 6 aa |
| Standard deviation of domain lengths | 6.19 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 55.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0351 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S9WWE2 | 67-151 | MPFFDVQKRLGLNLDQWMTIQSAEQPNKIAGRCHAFEKEWIECAHGIGGIRAEKECKIEYDDLVECLLRQKTMKRLNTIRKQRDK |
| A0A803T7U4 | 86-173 | MPVFDLQDQLGIDIDRWFLIQSGKQPFNRPSVCHAFEKEWLECSEGIGQTRAKKECRLEMEDLTECINMHKMIKRLVAISKQREKLMK |
| A0A4Z2BJV8 | 140-224 | None |
| A0A3M0IR92 | 1-79 | None |
| A0A2K5CVE2 | 1-89 | None |
| A0A212CH38 | 79-173 | None |
| A0A7M7LLL8 | 1-92 | None |
| B5XEU6 | 1-80 | None |
| A0A553Q2Y4 | 1-87 | None |
| A0A7F8RMU8 | 1-77 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.