DPCstruct | MC20209
Metacluster Properties and Pfam Annotations
| Number of structural domains | 87 |
|---|---|
| Mean domain length (aa) | 155 ± 28 aa |
| Standard deviation of domain lengths | 27.71 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 80.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 20.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0182 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A847LJX5 | 251-384 | AETRLWLNKSVDLFVTIFPKVLLGLFLSGILAAGIQLSDPRLMAVFDTNSLQGNFLAAFIGSLMYFGTIVGVNIVATLMRYGMHAGP… |
| A0A832XDB9 | 3-146 | FLFTFQDLLLETAPWLLLGLFSAGVVKAWIPEALVFRWLGGNGWKPILRGALVGTPLPLCSCGVIPMAMGLRRKGASKAATVSFLVA… |
| A0A2G6M1D8 | 16-163 | None |
| A0A2N0QLF0 | 2-127 | None |
| A0A447QMZ1 | 57-228 | None |
| A0A7W1YRR1 | 22-228 | None |
| A0A2H0QJX2 | 5-142 | None |
| A0A645HFF4 | 4-120 | None |
| A0A419GTL3 | 55-194 | None |
| A0A0M8UFP0 | 21-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.