DPCstruct | MC20200
Metacluster Properties and Pfam Annotations
| Number of structural domains | 600 |
|---|---|
| Mean domain length (aa) | 194 ± 41 aa |
| Standard deviation of domain lengths | 41.41 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 83.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.40 |
| Mean intra-cluster sequence similarity (%) | 11.53 |
| Pfam Score | 95.59 |
| Assigned Pfam label(s) | CL0023- CL0273- PF02179- PF05011- CL0632 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A498KJ94 | 2-199 | EVEVKLRLLDAAAHRQVTTLLAPFLVATHRQENFFFDGSKAELSARLAVLRLRFSDRSPLCAVTLKARAVLVDGISRVEEDEEELDH… |
| A0A0N8W9Z7 | 7-207 | SEVECKYKINSLANYHQVLEYLKNSYSLQTCQKLTNYLLDTTGFKLRERKLILRMRISPEQNLISLKGKNQIIDGLNFARRIEIEFS… |
| A0A4S4DMR0 | 121-357 | None |
| A0A3L7WEH2 | 34-246 | None |
| A0A3Q0IIN0 | 58-261 | None |
| A0A3N5F6R3 | 13-197 | None |
| A0A811LJS0 | 19-205 | None |
| A0A1E5B919 | 7-149 | None |
| A0A5S6Q6K7 | 13-188 | None |
| A0A317VWN9 | 1-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.