DPCstruct | MC2020
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 119 ± 16 aa |
| Standard deviation of domain lengths | 15.96 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 28.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A668AAB0 | 2-130 | SNDRCWRCDKERGTLIHMFYECDVVHSLWGAVIQCINNALKVKLRENPALCILGILQRKIGLSQQLRLWVKLALATGNRVILRHWKS… |
| A0A803T586 | 11-136 | NKNNNEKCWRGCQEIGTYMHMWWDCKHLTSYWKVVQTECNKILKSKFELKPEIFLLGLSDPKENLDANKDKLFTYFITAARIIIAKH… |
| A0A7J5XFD4 | 117-221 | None |
| A0A670JHA9 | 805-941 | None |
| A0A0G2JUT3 | 314-439 | None |
| A0A2H6N757 | 60-200 | None |
| A0A3B5PRH3 | 698-826 | None |
| H3B1Z1 | 228-340 | None |
| A0A452TRQ8 | 15-123 | None |
| A0A671TUA1 | 2-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.