DPCstruct | MC202
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 67 ± 7 aa |
| Standard deviation of domain lengths | 7.27 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 57.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6T1QTB0 | 78-151 | VATQAAEVDGPPEPQRGQLVKIVSPDSHWNGQVGKVLKVDIRNGLRFKDPVLVRFDEPDFKGSTSAYFALDEVQ |
| Q2JXQ1 | 1-63 | MAIQRGAKVRVLRKESYWYRDVGTVAAVDTSGILYPVIVRFDKINYYNINTNNFREDELEVVE |
| A0A812LJR3 | 13-83 | None |
| A0A0G4H6U3 | 45-106 | None |
| A0A812LWQ7 | 25-85 | None |
| A0A803LAG2 | 5-73 | None |
| A0A813DCV0 | 66-128 | None |
| A0A0A0LJQ1 | 147-220 | None |
| A0A2U1PRR3 | 231-304 | None |
| A0A2I0L7Y7 | 1-55 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.