DPCstruct | MC20199
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 422 ± 53 aa |
| Standard deviation of domain lengths | 52.69 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 68.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.58 |
| Mean length-normalized TM-Score | 0.22 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 14.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F4GTJ6 | 8-367 | IRSHARHSHLLTRRLTALQEGHSQLWDAICETHDKIEQAQIAENKTMERHVRRMFAKTRKLRQRMEDFDAKQEEVKSEMKVLDDALQ… |
| A0A6A6GUC2 | 3-411 | SAAEPIAETSIRAGDASPNSHDQHTNAPRSHPSFSPNGVQVVTVNKEQAEVYALLITPELLDCLQNNISTFKNADSLDKQISYLEEG… |
| A0A2S7NQX5 | 122-510 | None |
| A0A1L7XS20 | 5-435 | None |
| H0EE43 | 2-345 | None |
| A0A6A6HXJ7 | 182-664 | None |
| A0A6A6HVT6 | 110-547 | None |
| A0A0D1XPT0 | 39-492 | None |
| A0A6A6HX74 | 304-826 | None |
| A0A838EJ49 | 162-547 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.