DPCstruct | MC20198
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 243 ± 8 aa |
| Standard deviation of domain lengths | 7.78 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 69.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 24.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N6JME8 | 1-230 | MPTTRLVPLHKQQHILMDSENFREHAEKRQQEAVDRMKETRYRLQEAHQKLDNWKHYYDDEYAGYTLAVKNGTMEPASSFFDLILLQ… |
| A0A1L7XS20 | 188-428 | ETTMFRDLKEVLETNHLLEEDSDSESGVQGDTMDYEAQESHRNESDLSLSELERQELEVEREAVKQYVKDSHFRLQDARDKVENWKT… |
| A0A6A6GUC2 | 170-412 | None |
| A0A2S7NQX5 | 270-515 | None |
| H0EE43 | 89-342 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.