DPCstruct | MC20197
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 105 ± 6 aa |
| Standard deviation of domain lengths | 5.51 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 85.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 41.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A822A231 | 17-114 | HWLKLFIRSDYAGNALVHHESGFPLYSYAPELKHGQWFPPTFQCSRNNTLPRQWIVTYAVPFFGLDALGINLEFKGVVRVDAYLSYL… |
| A0A2C9KRM4 | 337-441 | KVYKLRAYLRSDSNGSSTAKHEHFPVTYKAATYKLGFWTRPYFRCDGYVNAWVLKYVVPFFGVNRRKLEFRGVTTVEVPLNLLEINQ… |
| A0A7R8W2E5 | 941-1047 | None |
| A0A8B6C4M4 | 150-259 | None |
| A0A816PYD1 | 125-238 | None |
| A0A482VLI9 | 287-393 | None |
| A0A1I8IUR5 | 486-590 | None |
| A0A183W704 | 19-127 | None |
| A0A7J7JPC4 | 49-147 | None |
| A0A2H1CUZ9 | 101-212 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.