DPCstruct | MC20196
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 154 ± 14 aa |
| Standard deviation of domain lengths | 13.71 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 47.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821ZYG8 | 1-141 | MATYNVLFEILVEKVSGLLVEKRTSEITPDWKIENPAMIKVIATLLRHASDNIHQYDIKLRFLDDLILLASASRDNRRTILQMSVWQ… |
| A0A0M3KHH5 | 68-229 | LFTLLTDRLLLNASYLSLATYNALFEILVEQMTPLISYTSHVPITDALSFENPTLLKVIANLITQSEERPELIKVKRVFLEDLIKMC… |
| A0A7R9IVB9 | 444-610 | None |
| A0A4Z2EER1 | 24-166 | None |
| A0A0R3TFG6 | 2-145 | None |
| Q19317 | 867-1026 | None |
| A0A2G8LA92 | 707-868 | None |
| A0A0K0EAS9 | 900-1066 | None |
| A0A817QFF4 | 172-338 | None |
| A0A6V7U064 | 9-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.