DPCstruct | MC20195
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 221 ± 15 aa |
| Standard deviation of domain lengths | 15.25 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 72.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 54.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08074 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183EHB6 | 92-293 | PVKKESESTKVIRSKGPRPSFKFNIADGGFTELHTLWLNEEKAAVPGNEFEIWHRRHDYWLLVGIITYGYGRYQDLQNDPRFAIINE… |
| A0A0M3KB69 | 91-305 | KETTPDSNSNSRMETDKEEDKMETDEGAPKGVVSKEEDRKNRAPRPSFKFNIADGGFTELHTLWLNEEKAAVPGNEYEIWHRRHDFW… |
| A0A493TZQ9 | 570-777 | None |
| A0A0C2MIY8 | 276-503 | None |
| A0A817F8U5 | 415-624 | None |
| A0A2R7WMA9 | 210-455 | None |
| A0A0C2CR21 | 777-993 | None |
| A0A4C1YMQ3 | 38-280 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.