DPCstruct | MC20193
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 252 ± 26 aa |
| Standard deviation of domain lengths | 26.05 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 68.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.56 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 27.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0229- CL0329 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G8LFH6 | 291-557 | IFNRSRLIKMYEALDLQREDSLLYRGIVGMVEVPSIVLEPTSNKQDFADRMEYRFLRKIMKDHMMQYWKDINIEKQGVKKFWESYGY… |
| A0A821Z2A8 | 1-244 | MYEKLGQPNKKTVYCRGVVGIVDIPSIVLEPTHNKQSFADEKEYHFLLKNMGEYMRQYWSDAGIENYVKEFWETYGYRDDQLDRPPS… |
| A0A455AZN6 | 384-674 | None |
| A0A5N5PD06 | 295-491 | None |
| A0A0S7FIQ5 | 11-260 | None |
| A0A5J4N5X7 | 132-413 | None |
| A0A402F381 | 3-262 | None |
| A0A444UKL9 | 342-548 | None |
| A0A5C6PQ46 | 533-760 | None |
| A0A3M7SX30 | 235-494 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.