DPCstruct | MC20192
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 169 ± 10 aa |
| Standard deviation of domain lengths | 10.14 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 68.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 27.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0V1KRI1 | 2-180 | NSTTNSSDEIEAPNTRQRHALAATPQLATVTTASTARTSSRTTEGKETEKRLYTQWSNQAWQLFFEGLKQHGKDFEAIRLYIAGKLK… |
| A0A821YXH9 | 1-172 | MNDTIEENKIEVLPPIPNVIEDSIASRTKEITKRPKRERSPTHQVQPSAPKIKKIKEVAPKLSDKTKWTMEEQKQFFSALRIYGKNF… |
| V4APH2 | 73-246 | None |
| A0A4Y7MIG1 | 110-268 | None |
| A0A1I8GSN3 | 38-201 | None |
| A0A4U5M6H3 | 1-151 | None |
| A0A077ZH21 | 1-189 | None |
| A0A0L8GMT1 | 114-280 | None |
| A0A819A4C3 | 1-173 | None |
| H2Y2L7 | 41-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.