DPCstruct | MC20190
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 172 ± 27 aa |
| Standard deviation of domain lengths | 26.53 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 80.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 30.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A815TYC6 | 1-150 | QWFPPTFQCSRNYTLPRQWIVTYAVPFFGLDTLGINLEFKGVVRVDAYLNYLDINQCSMPEYVPNAFKGSDRCDYQSTVCEPIFGRG… |
| A0A821YPB1 | 5-184 | SALVPHESGFPLYFHAPELKHGQWFPPRFQCSQNHTLPRQWIVTYAVPFFGLDTLGINIEFKGVVRIDTYLSYLDINQCSMSHYVPN… |
| A0A183W704 | 5-202 | None |
| A0A665UK51 | 229-423 | None |
| A0A267FTW9 | 727-907 | None |
| A0A820KAY7 | 15-167 | None |
| A0A3Q0JIW5 | 189-328 | None |
| A0A1I8I2D2 | 401-530 | None |
| A0A1I8IUR5 | 62-256 | None |
| A0A814UDA7 | 563-729 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.