DPCstruct | MC2019
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 115 ± 19 aa |
| Standard deviation of domain lengths | 19.49 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 80.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 28.70 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0261 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A803T4R0 | 1-137 | MLPAGGNWWGLENTHRMAIFLVCRTGYRSTSLCCRFNSNYVMRMRYMFELKENDNACQQAYNSGAFFLFHNLSPLLRQKEKRFWAPK… |
| A0A2G8K1G2 | 2-92 | SERVDRLRFMQKLKEDESVCQKFISEGYFAVFCNLKPLIGEAGVLWKSYADIIKLLSSFSVDPMRDSIFVTVDEPEESPPKFAINIS… |
| A0A6B0QMY8 | 3-112 | None |
| A0A673BCQ1 | 21-111 | None |
| A0A7R8XFZ8 | 90-198 | None |
| A0A803W9N2 | 1-129 | None |
| A0A0V0ZVI3 | 573-719 | None |
| A0A671PS39 | 4-126 | None |
| A0A3Q4NBK5 | 21-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.