DPCstruct | MC20186
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 75 ± 9 aa |
| Standard deviation of domain lengths | 9.12 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 29.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A182K275 | 137-201 | TSSAKGDIEIVEVEPEGKYVKLHNKSGKEVQIGGWSLLRKVGSNETVFKFHRTLKVDGGAFVTVW |
| A0A821Y795 | 1-75 | KGPISIAECDSQGKSVTVENTSRSKSMVLTGWTIRQQSESGETLTYTFPDNCLLRPNHSIKVKIFYLLYLYFYFF |
| A0A1I7WBL1 | 164-232 | None |
| A0A183U925 | 1-72 | None |
| A0A2K5Q689 | 417-498 | None |
| A0A820SGH2 | 126-208 | None |
| A0A6J2C2R4 | 387-479 | None |
| A0A0M3KKQ6 | 16-92 | None |
| A0A7M3Q5F4 | 61-123 | None |
| A0A212D191 | 278-344 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.