DPCstruct | MC20180
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 402 ± 52 aa |
| Standard deviation of domain lengths | 51.65 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 33.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A820V990 | 1-333 | LLFHDEINDRNKKIYQDLLEHWSHQLPKSYEIMIKIMMDIDFLINAFENEQYQLIFIHHMINLCFQQESIYQILSDGLLNLNNELFL… |
| A0A821WSU1 | 1-448 | MNDLEDHIKDQLRRFLNANYFPMLLPDVAWILTYLKQQTNSKSTQIIQRIFQKSDSLQISIEKYLDSRSYSITSHEFPLVRDILIRS… |
| A0A820CKE9 | 222-603 | None |
| A0A817YTZ6 | 1-454 | None |
| A0A821R4Z5 | 482-803 | None |
| A0A820WAV7 | 2-388 | None |
| A0A815VBU9 | 431-806 | None |
| A0A814RXK3 | 107-497 | None |
| A0A819U247 | 852-1231 | None |
| A0A818CVE9 | 413-906 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.