DPCstruct | MC20177
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 76 ± 6 aa |
| Standard deviation of domain lengths | 6.19 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 30.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C6B9M3 | 2-73 | KKSKYERILDIHIALEKGKCLFKVELANEYEVNERTIQRDIDDLRAYYSESFLTLGVKEIIYDRTDNCYKVA |
| A0A4R8GCI8 | 9-78 | TIRVLSLFEMLNNGEIIRKKEAAERFKVSEKTIHRDLKEINIYYSKYKYNTLVNSVAYNRVEKGYFLKVR |
| D2JD30 | 21-91 | None |
| A0A7H0TZT6 | 4-75 | None |
| A0A139P560 | 1-81 | None |
| A0A1S9BXB1 | 1-91 | None |
| G6C4V3 | 19-95 | None |
| A0A372LQB1 | 87-155 | None |
| A0A250DYJ8 | 3-76 | None |
| A0A5B7T602 | 6-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.