DPCstruct | MC20176
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 113 ± 16 aa |
| Standard deviation of domain lengths | 16.02 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 92.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 43.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y5S102 | 41-135 | YEVTAGQYTDFLNAVAATDTYALYNTSMWTSGFGCKIQRVGDEGSYTYSVAPDWANRPVNLVSWGDAARFANWLHNGQPTGPQDLTT… |
| A0A7Y5SKQ7 | 2-104 | DYIYNIGKYEVTAAQYTAFLNAVADTDTYGLYSTNMWSNEDGCRIQRTGSAGNYEYTVAADWADRPVNYVSWGDAARFANWLHNGEP… |
| A0A351FRB3 | 625-715 | None |
| A0A523EM38 | 93-209 | None |
| B3JEC0 | 344-443 | None |
| A0A7L5BEB5 | 336-468 | None |
| A0A7X8Z0F0 | 49-166 | None |
| A0A524GK21 | 212-351 | None |
| A0A1G3ZMQ2 | 159-279 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.