DPCstruct | MC20175
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 158 ± 16 aa |
| Standard deviation of domain lengths | 15.50 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 27.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A839ESE1 | 3-150 | KVKITSKGWHTYSSHLCGVKFHDGVSVEPLNDATINRLAATITIVRLDEEGVESPAGAAYDLIAASAARAPVLPKLMRQSDAEAAAE… |
| A0A7G8Q4G3 | 4-141 | AQRIKIVEKGWGNFNGTFGGVEFLNSLSVEAVAPSVARQLGSLVRIELCDSEAQITSNSDYLANKDTPAKVESTLIDVETANEATKE… |
| A0A379PLE6 | 1-158 | None |
| A0A439REX5 | 1-161 | None |
| A0A556UV45 | 1-177 | None |
| A0A844HS86 | 7-164 | None |
| A0A455UAW0 | 1-123 | None |
| A0A285XXK7 | 4-171 | None |
| A0A1G4UPT0 | 6-181 | None |
| A0A5A9EW73 | 54-222 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.