DPCstruct | MC20173
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 97 ± 12 aa |
| Standard deviation of domain lengths | 12.04 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 78.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 36.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A536TES4 | 3-81 | LPRTLNWVESLPSSVKPTALLRQYPRIANVFAATWEDPVALSSYIACLFLDDRGDRKGFAPDVLSELVALRDYHAKLAG |
| A0A536X0K0 | 6-97 | HQRLRKATPAETPLRRTLDWAESLPPRVRPKSLLRQYARVANLIAATWADLESFETYMESLLIDKRGSRKGFPPDVMAELQALELYR… |
| A0A1F4DMJ8 | 6-83 | None |
| U3G6T7 | 46-156 | None |
| A0A5C8P0D8 | 37-136 | None |
| A0A0Q4YB50 | 14-124 | None |
| A0A7W0X698 | 46-124 | None |
| A0A059KHV0 | 7-104 | None |
| A0A257D9L4 | 24-130 | None |
| A0A536UF30 | 33-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.