DPCstruct | MC20172
Metacluster Properties and Pfam Annotations
| Number of structural domains | 92 |
|---|---|
| Mean domain length (aa) | 157 ± 25 aa |
| Standard deviation of domain lengths | 24.64 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 71.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.56 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 27.90 |
| Pfam Score | 87.32 |
| Assigned Pfam label(s) | CL0123- PF14774- CL0105- CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T6DA88 | 21-121 | LINLQDFLEHVQLMRSDDFYEKVAHTSPQLARFFEERNPRLLRRIESIILSMTIFERRNPRVLKLSLSRRARVAVGSGVPMSHIDDL… |
| A0A536WQ51 | 16-156 | DVDEAKKFAEKLKKGKGFDLEDFKQQIGQMRKMGGISSMIDKLPAQFAPAAQSAQMDEKQLRRVEGIINSMTPAERMRPEILKASRK… |
| A0A7S2LAC0 | 1-160 | None |
| A0A0D9XP62 | 908-1049 | None |
| A0A099NPK1 | 3-158 | None |
| A0A3D0IBW7 | 4-136 | None |
| A0A812NMD9 | 297-448 | None |
| M1VD16 | 1-186 | None |
| L1LGH5 | 6-206 | None |
| A0A836QUR2 | 125-278 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.