DPCstruct | MC20166
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 105 ± 17 aa |
| Standard deviation of domain lengths | 17.43 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 91.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 21.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02631 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1T4LWC2 | 1-103 | MPYLTIKDKGTRKLLNIDDEYIGFVYQSDINEYDLNDGTDIDITKVEDLHSLIFKRTYKKALSYLERSEYCASEIRFKLKMNDYSSV… |
| A0A061PF40 | 2-103 | KITKISIQKNNKERYNVFGSLNGQQEQFVFGVHESVLIKHRLQKGTTLTDGQMKEIQEEDQLAFAKSYALSYVSRKMRTETEVENVL… |
| A0A1G7QPB4 | 2-68 | None |
| A0A381ICP2 | 3-84 | None |
| A0A7Y5G8A1 | 1-122 | None |
| A0A660M9M8 | 30-145 | None |
| A0A7W4HI24 | 10-90 | None |
| A0A1K1N6J0 | 2-98 | None |
| A0A1V6EI40 | 5-126 | None |
| A0A2D9YXF7 | 10-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.