DPCstruct | MC20163
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 101 ± 11 aa |
| Standard deviation of domain lengths | 10.98 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.76 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 44.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V8ISD5 | 7-112 | SITRAAIRLVSKTRQSNLALDEGLTNWEGEFLDGLEERLQKYGSAFNDPDLGATCGALSLRQGLKLKQIKRKAQPKKTVKALLPKTG… |
| A0A840I2A4 | 27-106 | EKKARERSARNAQRKIARLRKTLAENGEITDFEDEFAGSVAERLDKYGAAFADPGLGRPGDALSSAQKRVVASMNRKVKE |
| A0A840A8E6 | 7-100 | None |
| A0A7W6A478 | 25-125 | None |
| A0A258HPN4 | 14-115 | None |
| A3UH51 | 3-116 | None |
| A0A3B0RY73 | 9-118 | None |
| A0A2S8W898 | 1-90 | None |
| E8RQB1 | 32-123 | None |
| A0A2D8FLL4 | 11-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.