DPCstruct | MC20162
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 115 ± 17 aa |
| Standard deviation of domain lengths | 17.05 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 22.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C5SE94 | 3-112 | KVLLDALRPTVETDLGQPVQFVVRTLRVQGDWGFAVVMPRTKDGREIDYRKTRHAQRIRDGVFDGGTVEALLHNQAGRWTVRDFAVG… |
| A0A7V8DRH8 | 30-154 | FPTAFAQSRSYSPRPGSAERRELLNLLRPIIARDLGAPIEFVVNEIKVSGYYAFVSVDAQRPGGRRIDPAKTKWAGRHYPDIIDCCH… |
| A0A1J5HZX6 | 243-361 | None |
| A0A6C1PDW3 | 97-222 | None |
| A0A7T5VDP9 | 13-116 | None |
| A0A5P9GB90 | 16-139 | None |
| A0A7W9A488 | 157-280 | None |
| A0A0Q9CS35 | 15-134 | None |
| A0A564GPJ7 | 19-143 | None |
| A0A239JQE8 | 464-576 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.