DPCstruct | MC20161
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 134 ± 13 aa |
| Standard deviation of domain lengths | 12.80 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 75.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 31.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10768 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V8DNB9 | 56-192 | MKVEGVSSNQAAALRRANGVAAPGFALPIGDGNAVQATRAAAATSAMMDIGSLLALQTIDSIEERRRRATRRANTLLDILDDVRVAT… |
| A0A841J0E5 | 1-115 | MATPPSADAGALSIPTSPTTLGSIQMLVALAAVSPTEERRRIQSAQARQGLDTLDRLHRELLSGRANRATLDQLAQWLQTRPDATRL… |
| A0A227JMF5 | 14-140 | None |
| A0A3S2W7B4 | 1-118 | None |
| A0A2W5KUG1 | 65-198 | None |
| A0A257RAF6 | 5-130 | None |
| A0A357LCG2 | 2-131 | None |
| A0A317FGW0 | 71-239 | None |
| A0A1B1ALD4 | 1-133 | None |
| V4NMT0 | 1-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.