DPCstruct | MC20160
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 129 ± 9 aa |
| Standard deviation of domain lengths | 9.34 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 41.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00920 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M9F6J5 | 1-128 | MNPVISAVTERIKARSAESYSQWLAMTKEMEQAGKGRSQLSCGNLAHVVAANCAQEKSAILDFLHANIAIVSGYNDMLSAHQPYKFY… |
| A0A7V8AB49 | 1-144 | MHKIHPILEQVTANIEARSKSLRSRFMKRTKAYASKEPRRKRLSCANYAHVVAASSEIDKLQAALDRVPNIGIVTSYNDMLSAHQPY… |
| A0A154TSM0 | 3-121 | None |
| A0A1H9VBG1 | 1-108 | None |
| W9TXE5 | 1-139 | None |
| A0A840NST6 | 6-133 | None |
| A0A485A7W0 | 1-129 | None |
| A0A090SKX7 | 1-132 | None |
| A0A0A2VCR2 | 1-128 | None |
| A0A4P0UB23 | 1-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.