DPCstruct | MC20153
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 79 ± 6 aa |
| Standard deviation of domain lengths | 5.65 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 79.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 34.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0169 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7U4KCZ2 | 1-85 | MVKDEMTDESALPESEQARRMIRRAVLRMVGSGQLHSRDDVIRYLIKEGGFDILSVTDTSVTLCAPDEPEETLTLTGWVFSSSFR |
| A0A1C7WA93 | 1-75 | MSDNNEARKIITDTIKGLVGGRVIHSREDIIRFLCGEGFDIPDVSEDSITVSAPDEPGNTLTFTGYLFSSQFKLT |
| A0A0H5Q6W4 | 169-246 | None |
| A0A2T1BY92 | 188-266 | None |
| A0A6C8MEC5 | 72-146 | None |
| A0A6H0A9Q4 | 13-98 | None |
| A0A151Z2F0 | 247-319 | None |
| A0A2C9LVM1 | 19-93 | None |
| A0A078LRL4 | 4-85 | None |
| A0A168QDW0 | 11-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.