DPCstruct | MC20151
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 198 ± 7 aa |
| Standard deviation of domain lengths | 7.44 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 77.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 48.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4X6K8 | 1-206 | MQTCLYKALIVAPTDVTLQTHLTSMGPGFVWDAASLLGLLTEDDLRNLLMDPDAVRAWLRRQHQLPETQRPAGLPADLRSPRDLCDL… |
| A0A6A4WVV4 | 504-691 | PADLADGEPMTSPVGDAVTLDVTPLTRLLTDSDLVYLLGEPAAVAAWCRRERPAGLTAEPDTPRGRAELLLRPELLLRALGEAVPRW… |
| A0A6A4VWX9 | 101-306 | None |
| A0A6A4VSN4 | 318-501 | None |
| A0A6A4V6V3 | 151-349 | None |
| A0A6A4WIU4 | 189-390 | None |
| A0A6A4X860 | 181-379 | None |
| A0A6A4UT21 | 386-584 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.