DPCstruct | MC20150
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 254 ± 29 aa |
| Standard deviation of domain lengths | 28.55 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 78.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 23.88 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | CL0396- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| P34283 | 208-433 | MEVVEHIPLPNAKKFVENVLGTLMPRIFIFSTPNHEYNAVFGMEPGEFRHGDHKFEMNRKEFSNWLEELSIRFPHYQIDPPHYIGMT… |
| A0A6A4X4V5 | 13-261 | RALPAALFGFLRPRLVVLTTPNAEFNELFPGFTGMRHWDHKFEWTRAEFQQWCAGVVSQYPEYEVSFDGIGPPPAGSERLGCCSQMA… |
| A0A1A9V8G4 | 65-331 | None |
| A0A6A3AZ95 | 119-355 | None |
| A0A4S8MW40 | 228-551 | None |
| A0A0D0V9T5 | 3-263 | None |
| A0A6P4Q590 | 579-790 | None |
| A0A6G0U512 | 29-326 | None |
| A0A1B9IPI5 | 206-432 | None |
| A0A5B0PX69 | 168-423 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.