DPCstruct | MC2015
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 122 ± 12 aa |
| Standard deviation of domain lengths | 11.95 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 23.31 |
| Pfam Score | 93.29 |
| Assigned Pfam label(s) | CL0172- PF21109 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U9BB22 | 685-803 | SQNGLHEETLSAEHAVCFIFTSLGSAEPYLSALSNYLKVSIKPDDPQDPHAHDVEKEQWYLSKQVFDTLREKAKLFSDFAEANKENK… |
| A0A6A5EG53 | 131-263 | MEGIKIVPNQSALDRQVFARGVEDALCFVFTSVERGDTYLDVMAGYLDYPKLGSTNEDPWYYSNEVLNKMRKKAKAFQHFANAQKSN… |
| A0A7M5U144 | 1-91 | None |
| A0A7M5VGG4 | 414-537 | None |
| A0A7R8X5Z1 | 217-334 | None |
| A0A7R8ZZF3 | 176-292 | None |
| A0A1X7SFC2 | 4-123 | None |
| A0A498MEQ0 | 343-464 | None |
| A0A6G0HX93 | 136-258 | None |
| A0A0F8CZ11 | 383-501 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.