DPCstruct | MC20142
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 67 ± 10 aa |
| Standard deviation of domain lengths | 10.02 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 42.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0198 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q3DGM2 | 59-142 | INDKEHGLQFKTEVLKATAPTSLEGIEKYLASRLIKGIGPVYAKKLVDAFGQQVFSVIEEFPEQLRTVNGLGKSRIEVICTSWQ |
| X1L4F9 | 15-79 | PTSLLGLKRYLSSGLIKGVGPATADRIVKQFGDKTLEVLENDLQRLTEVEGIAEKRVEMISKSWE |
| A0A1D2P7P5 | 16-84 | None |
| A0A257SUE3 | 136-206 | None |
| A0A1Y5EEG9 | 671-729 | None |
| A0A3S6Z139 | 78-152 | None |
| A0A5P8WDF7 | 2-51 | None |
| A0A1V5RDL8 | 71-142 | None |
| A0A7X6CQW8 | 21-79 | None |
| G1WPJ8 | 72-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.