DPCstruct | MC20139
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 171 ± 24 aa |
| Standard deviation of domain lengths | 23.88 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 68.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 32.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12579 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A2Y169 | 26-184 | RHNPGISVNWTPDEQLTLEDLLAKYASDSTIVRYAKIAMELKDKTVRDVALRCRWMTKENGKQRKEDHSSARKIKDKKFIELHLGVT… |
| A0A5D2R1S8 | 4-181 | ATEWSTEEQYILKDGLEKYKEEPNIMKYIKIAAVLPDKTVRDVALRCRWLQIKRRKPEELNAGKKVNNRKDKQVESSSKMNTPTALP… |
| A0A251SJY5 | 7-167 | None |
| A0A1Z5RPI9 | 14-209 | None |
| F6GX50 | 1-154 | None |
| A0A453DEI8 | 2-164 | None |
| A0A6P5FPY8 | 298-481 | None |
| M4CKM9 | 2-206 | None |
| A0A6N2B1Z2 | 12-143 | None |
| A0A3L6PYA5 | 45-262 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.