DPCstruct | MC20138
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 98 ± 14 aa |
| Standard deviation of domain lengths | 14.43 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 71.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 50.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5D2QV97 | 3-95 | NKKVPLWRTVLLKYYKHASNGANELTSTRAKRLFHRDEFVRCSRCKKERRFRLRTDEECRRFHDAAKARKWKCANWPYDKITCKVDE… |
| A0A2G9HQ24 | 80-162 | WKSQIWVFGHDGQKIALWRTCLLKHHTQTFQRPLRQVIHRDEFVRCSQCNKERRFSLRSKEACRFYHDALLNNNWKCSNMPNN |
| A0A438EFF6 | 160-241 | None |
| A0A834X249 | 76-202 | None |
| A0A5N5J0N1 | 272-350 | None |
| A0A5J5A582 | 4-96 | None |
| A0A830DHI9 | 1-92 | None |
| A0A2U1LW61 | 24-129 | None |
| A0A445KEI3 | 167-256 | None |
| A0A834H3R3 | 128-230 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.