DPCstruct | MC20137
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 55 ± 7 aa |
| Standard deviation of domain lengths | 6.70 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 50.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D0HB76 | 113-162 | LYITERCVFRLTQEGVELTEIAPGMDLEKDILAYMDFKPIVKNLKTMDAR |
| A0A4Y7RC34 | 1-69 | MYITERAVFKLEKEGMTLIEIAPGSDLEKDVLAHMDIKPVLSPDLKLMPEGIFQPEWGQLKEIINQKTS |
| A0A485CA88 | 31-79 | None |
| A0A238J544 | 301-358 | None |
| A0A7S3PPC5 | 229-280 | None |
| A0A645JLG7 | 23-82 | None |
| A0A485JHF9 | 2-46 | None |
| W0ITE7 | 31-91 | None |
| E0E126 | 49-106 | None |
| G9YHM1 | 152-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.