DPCstruct | MC20123
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 93 ± 9 aa |
| Standard deviation of domain lengths | 9.38 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 30.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B3CL92 | 1-97 | MRARVKLLLPLILLLSTGNFCSKSTVLRTQTACNSCHMSLFIACPSGYKRTPRSPITSCRYAIKTSSVVLAVPGCSLECYREVEVQS… |
| A7S9Z4 | 1-84 | CSEKREEVRRTVCNECSHNSLRQCPSGYTQDSSGIGVHDANTCRLTLSFTDGRIVRIGGCYHLCRRNISVEQCCSGYWGKDCQG |
| A0A6P6D210 | 8-110 | None |
| D3ZWH1 | 647-734 | None |
| A0A7J5Z6F2 | 628-703 | None |
| A0A2I4AKF2 | 6-102 | None |
| Q3TP65 | 8-119 | None |
| A0A5C6MFL2 | 7-115 | None |
| A0A6J3HHQ5 | 96-188 | None |
| A0A4W5RRT7 | 53-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.